DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:128 Identity:45/128 - (35%)
Similarity:70/128 - (54%) Gaps:12/128 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLMLIALFVVAASATDNDDPISQ----ESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGE 63
            :::.:|...|:....|:.|..::    :|:::.:|.|.|.|:..:|....:.||        .|.
  Fly     5 FVLAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAGQESGV--------GGY 61

  Fly    64 SVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTPPPTPVSVLKALEYIRLHPYKTPEQKQ 126
            ..:|..::.|.||:...::||||.|||...|.|||||||.|.|:||:|||||.||.:...|.|
  Fly    62 YASGSNAYYAPDGQLIQLTYTADSNGYHPAGAHLPTPPPIPASILKSLEYIRTHPQQESRQGQ 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 16/54 (30%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 16/54 (30%)

Return to query results.
Submit another query.