DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Cpr64Ab

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:105 Identity:34/105 - (32%)
Similarity:49/105 - (46%) Gaps:14/105 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LMLIALFVVAA-------SATDNDDPISQESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHN 61
            :.||...::||       :|.....|::.|  |:.:.:|.:.|.::|.  .|.|.  ||.....:
  Fly     6 ITLICCALIAAIECALLPAAVPVGVPLNTE--VDPHPQYAFAYNVQDA--LTGDS--KSQQEVRD 64

  Fly    62 GESVNGKYSFVADDGKTYVVSYTADE-NGYLAVGDHLPTP 100
            |:.|.|.||.|..||....|.||||. ||:.||....|.|
  Fly    65 GDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQRGPVP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 21/55 (38%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790 21/55 (38%)

Return to query results.
Submit another query.