DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Cpr56F

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:73 Identity:21/73 - (28%)
Similarity:36/73 - (49%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NDDPISQESNVEYN-GKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVS 82
            |.:...|....:|. .||.:.|:::|.......|.::|    .:|:...|:|..:..||:..:|.
  Fly   111 NGNGYGQRDEEQYGPAKYEFKYDVQDYESGNDFGHMES----RDGDLAVGRYYVLLPDGRKQIVE 171

  Fly    83 YTADENGY 90
            |.||:|||
  Fly   172 YEADQNGY 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 15/54 (28%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 15/54 (28%)

Return to query results.
Submit another query.