DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Cpr49Ah

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:146 Identity:43/146 - (29%)
Similarity:63/146 - (43%) Gaps:32/146 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYLMLIALFVVAASATDNDDPISQESN-------------------------VEYN------GK 34
            ||.|:|:.|..::.....:.....|..|                         ::||      |.
  Fly     1 MKVLILLVLLAISCQGQHHHQHQHQNVNNIPRDDKPDHHRHEDHRETSTWIPIIKYNKEQSDDGS 65

  Fly    35 YHYHYELKDGSKATQDGVLKSVNADHNGESV-NGKYSFVADDGKTYVVSYTADENGYLAVGDHLP 98
            |...||..:.....:.|.||..:.:.||..| :|:||:.:.:|....|.|||||||:.|.|||:|
  Fly    66 YKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADENGFRATGDHIP 130

  Fly    99 TPPPTPVSVLKALEYI 114
            |||..|..:.|.|:.|
  Fly   131 TPPAIPEEIQKGLDQI 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 20/55 (36%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 20/55 (36%)

Return to query results.
Submit another query.