DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Cpr47Eg

DIOPT Version :9

Sequence 1:NP_001286347.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster


Alignment Length:128 Identity:42/128 - (32%)
Similarity:61/128 - (47%) Gaps:15/128 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYLMLIALFVVAASATDNDDPISQESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGES- 64
            ||:.:..|..:..|.|.::.:.:..|..|..:| :.|..||.:.....|.|       |.|||. 
  Fly     1 MKFFIAFACLLAVALANEDANVLRAEQQVNVDG-FAYAVELDNSVNVQQKG-------DLNGEEW 57

  Fly    65 -VNGKYSFVADDGKTYVVSYTADENGYLAVGDH--LPTPPPTPVSVLKALEYIRLHPYKTPEQ 124
             |.|..|:.:.:.....:.|.||.|||..|..:  ||||||.|.::.::||||..||   |.|
  Fly    58 VVKGSQSWTSPENVPVSIQYIADANGYQVVSANPPLPTPPPIPEAIQRSLEYIAAHP---PSQ 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_001286347.1 Chitin_bind_4 35..90 CDD:278791 16/56 (29%)
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.