DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Cpr47Ed

DIOPT Version :9

Sequence 1:NP_001286347.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:88 Identity:26/88 - (29%)
Similarity:46/88 - (52%) Gaps:9/88 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NGKYHYHYELKDGSKATQDGVLKSVNADHNGE-SVNGKYSFVADDGKTYVVSYTADENGYLAVGD 95
            :|.|.:.:|..||:...:.|::.|.:...:.: .|:|.|.::.|.|:...|.||||:||:|    
  Fly    40 SGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFL---- 100

  Fly    96 HLPTPPPTPVSVLKALEYIRLHP 118
                |....:|..:|.:.||:.|
  Fly   101 ----PHVRYISKGEAYKPIRIEP 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_001286347.1 Chitin_bind_4 35..90 CDD:278791 17/55 (31%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:278791 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.