powered by:
Protein Alignment Cpr49Af and Cpr47Eb
DIOPT Version :9
Sequence 1: | NP_001286347.1 |
Gene: | Cpr49Af / 36352 |
FlyBaseID: | FBgn0033729 |
Length: | 126 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610655.1 |
Gene: | Cpr47Eb / 36189 |
FlyBaseID: | FBgn0033598 |
Length: | 214 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 25/73 - (34%) |
Similarity: | 42/73 - (57%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 ESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYTADENGY 90
|:|...:|.:|:.||..|.|...:.||:::...:.....|:|.||::..||.|..|.|||.:||:
Fly 39 ETNKNPDGSFHFSYEGGDQSVRQEQGVIENAGTEDEALEVSGMYSYIDADGNTVEVHYTAGKNGF 103
Fly 91 LAVGDHLP 98
:.:|..:|
Fly 104 VPIGTIIP 111
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.