DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Lcp1

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_476619.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster


Alignment Length:133 Identity:37/133 - (27%)
Similarity:69/133 - (51%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KYLMLIALFVVAA-----------SATDNDDPISQESNVEYNGKYHYHYELKDGSKATQDGVLKS 55
            |::|:.|:..:|.           |...:.|.:||..:|..:|        .|.|..|.:|:.::
  Fly     3 KFVMICAVLGLAVANPPVPHSLGRSEDVHADVLSQSDDVRADG--------FDSSLHTSNGIEQA 59

  Fly    56 VNADHNGESVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTPPPTPVSVLKALEYIRLHPYK 120
            .:.|.:| :::|.:.:::.:|:...|.|.|:||||...|..:|||||.|.::.:|:.::..|| .
  Fly    60 ASGDAHG-NIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEAIARAVAWLESHP-P 122

  Fly   121 TPE 123
            .||
  Fly   123 APE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 13/54 (24%)
Lcp1NP_476619.1 Chitin_bind_4 46..93 CDD:459790 13/47 (28%)

Return to query results.
Submit another query.