DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and CG15754

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster


Alignment Length:87 Identity:22/87 - (25%)
Similarity:33/87 - (37%) Gaps:16/87 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADD--GKTYVV-SYTADENGYLAV 93
            :|.|.:.|.:..|.:..:.|.   .:.:.:|..|.|.|.....|  |..|.: .|.||..||   
  Fly   195 DGSYIFGYSIPHGIRRWEKGY---YSEEQHGRVVEGFYVQPRHDSQGLRYELRCYRADSEGY--- 253

  Fly    94 GDHLPTPPPTPVSVLKALEYIR 115
                   .|.||..|:....:|
  Fly   254 -------QPRPVEFLRTPPIVR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 14/57 (25%)
CG15754NP_572894.1 None

Return to query results.
Submit another query.