DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Cpr65Av

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:81 Identity:33/81 - (40%)
Similarity:44/81 - (54%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DNDDPISQESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVS 82
            |||       |:..:| |::.||..||....:...:|:...|....||.|..|:||.||:||.:.
  Fly    37 DND-------NIGTDG-YNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLH 93

  Fly    83 YTADENGYLAVGDHLP 98
            |.|||||:...|||||
  Fly    94 YIADENGFQPQGDHLP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 22/54 (41%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 22/54 (41%)

Return to query results.
Submit another query.