DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and Cpr49Aa

DIOPT Version :9

Sequence 1:NP_001286347.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:137 Identity:51/137 - (37%)
Similarity:74/137 - (54%) Gaps:13/137 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKY--LMLIALFVVAASATDN------DDP---ISQESNVEYNGKYHYHYELKDGSKATQDGVLK 54
            |:|  |.:.||.:..|.|...      .:|   |.||..|.::|.|.|.||..:|..|.::|.||
  Fly     1 MQYTLLFIAALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLK 65

  Fly    55 SVNADHNGESVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTPPPTPVSVLKALEYIRLHPY 119
            :...|:.|:...|.:|:.:.:|....::|.|||||:...|||||||||.|.::.|||.|:...| 
  Fly    66 NPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAYLATAP- 129

  Fly   120 KTPEQKQ 126
             .|.|:|
  Fly   130 -PPPQEQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_001286347.1 Chitin_bind_4 35..90 CDD:278791 19/54 (35%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.