DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and LOC1279293

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_318993.5 Gene:LOC1279293 / 1279293 VectorBaseID:AGAMI1_010278 Length:582 Species:Anopheles gambiae


Alignment Length:115 Identity:45/115 - (39%)
Similarity:62/115 - (53%) Gaps:8/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ATDNDDPISQESNVEYNGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYV 80
            ||:....|.||..|..:|.|.:.||..:|....:.|.||:...:...:...|:||:.|.||:...
Mosquito    26 ATEPIPIIRQEQEVNPDGSYSWSYETGNGIVTEEQGFLKNPGTEQEAQVAQGEYSYTAPDGQLIR 90

  Fly    81 VSYTADENGYLAVGDHLPTPPPTPVSVLKALEYIRLHP--------YKTP 122
            |.|.|||||:..:|||||||||.|.::.:||||:...|        |.||
Mosquito    91 VQYIADENGFQPLGDHLPTPPPIPPAIQRALEYLASLPPSDDASRRYPTP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 19/54 (35%)
LOC1279293XP_318993.5 None

Return to query results.
Submit another query.