DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Af and LOC1270213

DIOPT Version :10

Sequence 1:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_308892.4 Gene:LOC1270213 / 1270213 VectorBaseID:AGAMI1_006564 Length:120 Species:Anopheles gambiae


Alignment Length:111 Identity:26/111 - (23%)
Similarity:40/111 - (36%) Gaps:38/111 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 RYGMDVP--------NNVLQILPRSWSL---YLTILLVTLQLCLSSAVGNSALFQHIEDV----- 337
            :||.|.|        |||.:|:.:|...   |..:....:.:..|.|..|.|..:|.|.:     
Mosquito   682 KYGNDKPDTRFGFLLNNVSEIIEKSDEFKEKYDDLGAYAIVVRASEAFWNGAARKHYESLGKEFK 746

  Fly   338 -------LGASRDFTLKRCIIRSTLVWLGVLI-----AEILPRFDL 371
                   .|.::|...|          ||.|:     .|:..:|||
Mosquito   747 GTLFVRKFGPTKDVQEK----------LGKLLGEDVATEVADKFDL 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790
LOC1270213XP_308892.4 Chitin_bind_4 27..79 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.