DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ae and Lcp65Af

DIOPT Version :9

Sequence 1:NP_610774.3 Gene:Cpr49Ae / 36351 FlyBaseID:FBgn0033728 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:87 Identity:33/87 - (37%)
Similarity:55/87 - (63%) Gaps:4/87 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IAIISQESNIEPDGSYNYAYETANGIKAEETGTLKKATSPDSSDVIIARGSVSYTSPEGNLITLN 92
            :.|:.|||::.| .|:||.|||::|..|:..|.||...:.:  :.:..:|:.|:.:.:|...::.
  Fly    18 VQILKQESDVGP-VSFNYGYETSDGSSAQAAGQLKNVGTDE--EALNVKGTYSFVADDGQTYSIA 79

  Fly    93 YSADDENGFQPQGDHLPTPPPI 114
            |:| ||||:||||.|||..|.:
  Fly    80 YTA-DENGYQPQGAHLPVAPVV 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AeNP_610774.3 Chitin_bind_4 43..101 CDD:278791 18/57 (32%)
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.