DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ae and Cpr78E

DIOPT Version :9

Sequence 1:NP_610774.3 Gene:Cpr49Ae / 36351 FlyBaseID:FBgn0033728 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster


Alignment Length:151 Identity:39/151 - (25%)
Similarity:62/151 - (41%) Gaps:41/151 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FALCLLATALMSCCQA----AP-----QKAEEPIAIISQESNIEPDGSYNYAYETANGIKAEETG 59
            |.:.::|   :|.|.|    ||     ...:.|:||:........|||||::|...:|....|..
  Fly     2 FKILIVA---LSLCTAVVLSAPVDHVTSTTQPPVAILESSHEKHEDGSYNFSYLGEDGTHRREEA 63

  Fly    60 TLKKATSPDSSDVIIARGSVSYTSPEGNLITLNYSADDENGFQPQG---------------DHLP 109
            .::...:  .::.:...||.||....|..:|:.|.||| :||.|:|               :.:|
  Fly    64 VVRNQGT--ENEYLEISGSYSYFDANGQEVTVTYKADD-HGFVPEGGAILPQISLAAKQVSEQVP 125

  Fly   110 TPPPIPPAIQKALDYLLSLPP 130
            .|.         |||  :.||
  Fly   126 QPD---------LDY--AKPP 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AeNP_610774.3 Chitin_bind_4 43..101 CDD:278791 15/57 (26%)
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:278791 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.