DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ae and Edg78E

DIOPT Version :9

Sequence 1:NP_610774.3 Gene:Cpr49Ae / 36351 FlyBaseID:FBgn0033728 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster


Alignment Length:131 Identity:53/131 - (40%)
Similarity:76/131 - (58%) Gaps:16/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKNFALCLLATALMSCCQAAPQKAEEPIAIISQESNIEPDGSYNYAYETANGIKAEETGTLKKAT 65
            |..:..||   ||:.|..|.....:..|.....::. :.:|:|.|||||:|||:.:|.|....  
  Fly     1 MYKYLFCL---ALIGCACADNINKDAQIRSFQNDAT-DAEGNYQYAYETSNGIQIQEAGNANG-- 59

  Fly    66 SPDSSDVIIARGSVSYTSPEGNLITLNYSADDENGFQPQGDHLPTPPPIPPAIQKALDYLLSLPP 130
                     |||:|:|.||||..|:|.|:||:| |:.|.|||||||||:|..:.:||:|:.:.||
  Fly    60 ---------ARGAVAYVSPEGEHISLTYTADEE-GYHPVGDHLPTPPPVPAYVLRALEYIRTHPP 114

  Fly   131 A 131
            |
  Fly   115 A 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AeNP_610774.3 Chitin_bind_4 43..101 CDD:278791 26/57 (46%)
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 26/57 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.