DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ae and Cpr65Ea

DIOPT Version :9

Sequence 1:NP_610774.3 Gene:Cpr49Ae / 36351 FlyBaseID:FBgn0033728 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:122 Identity:48/122 - (39%)
Similarity:63/122 - (51%) Gaps:14/122 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATALMSCCQAAPQKAEEPIAIISQESNIEPDGSYNYAYETANGIKAEETGTLKKATSPDSSDV 72
            ||..||..|..|||...:   .|....:|.:.||:|.|..|.|:||:.:|.|.....        
  Fly     5 LLVVALFGCALAAPLNDD---TITKFLANQDTDGTYAYDIEQASGIQIKEEGLAGHE-------- 58

  Fly    73 IIARGSVSYTSPEGNLITLNYSADDENGFQPQGDHLPTPPPIPPAIQKALDYLLSLP 129
              |.||.||.||||..:.:.|:| ||.||.||.:.||||||||..|.:::.|:...|
  Fly    59 --AHGSYSYISPEGIPVQVVYTA-DEFGFHPQSNLLPTPPPIPEEILRSIRYIQEHP 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AeNP_610774.3 Chitin_bind_4 43..101 CDD:278791 21/57 (37%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:306811 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.