DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ae and Cpr57A

DIOPT Version :10

Sequence 1:NP_610774.3 Gene:Cpr49Ae / 36351 FlyBaseID:FBgn0033728 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:105 Identity:30/105 - (28%)
Similarity:46/105 - (43%) Gaps:24/105 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCLLATALMSCCQAAPQKAEEPIAIISQESNIEPDGSYNYAYETANG---IKAEETGTLKKATSP 67
            :||||.|           |.:...:::.|..: |...|.::|:....   :..:.|..      .
  Fly     7 VCLLAVA-----------AADVSHLVTPEPKV-PASPYVFSYQAGRAPGHVDRQHTEV------S 53

  Fly    68 DSSDVIIARGSVSYTSPEGNLITLNYSADDENGFQPQGDH 107
            |.|.||  ||:.||..|:..:.|:.|.| ||:||.||..|
  Fly    54 DGSGVI--RGAFSYVDPKNQVRTVQYVA-DEHGFHPQLSH 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AeNP_610774.3 Chitin_bind_4 43..101 CDD:459790 17/60 (28%)
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 17/60 (28%)

Return to query results.
Submit another query.