DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ae and Cpr11B

DIOPT Version :9

Sequence 1:NP_610774.3 Gene:Cpr49Ae / 36351 FlyBaseID:FBgn0033728 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:138 Identity:45/138 - (32%)
Similarity:66/138 - (47%) Gaps:32/138 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QKAEEP-IAIISQESNIEPDGSYNYAYETANGIKAEETGTLKKATSPDSSDVIIARGSVSYTSPE 85
            |:.::| |.|:..:.|.:.:|:||:.::|.|||..:|||..:......|..|   :||.|||..:
  Fly    63 QRQQQPQIPIVRSDYNSDANGNYNFGFDTGNGIHRDETGEFRGGWPHGSLGV---QGSYSYTGDD 124

  Fly    86 GNLITLNYSADDENGFQPQGDHLPTPPPIP------------------------PAIQKALDYLL 126
            |...|:||:| |:|||..:|.|||..|.:|                        ||...|..|  
  Fly   125 GKQYTVNYTA-DKNGFHAEGAHLPVSPSVPAAPAGRSSYGAGGSGYRGSASSHVPAAAPATRY-- 186

  Fly   127 SLPPAKRR 134
             |||..|:
  Fly   187 -LPPGYRQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AeNP_610774.3 Chitin_bind_4 43..101 CDD:278791 23/57 (40%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.