DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ae and Cpr49Aa

DIOPT Version :9

Sequence 1:NP_610774.3 Gene:Cpr49Ae / 36351 FlyBaseID:FBgn0033728 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:131 Identity:76/131 - (58%)
Similarity:86/131 - (65%) Gaps:7/131 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FALCLLATALMSCCQAAP----QKAEEPIAIISQESNIEPDGSYNYAYETANGIKAEETGTLKKA 64
            :.|..:|..|:|..||.|    |...|||.||.||..:..||||.|.|||.|||.|||.|.||..
  Fly     3 YTLLFIAALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNP 67

  Fly    65 TSPDSSDVIIARGSVSYTSPEGNLITLNYSADDENGFQPQGDHLPTPPPIPPAIQKALDYLLSLP 129
            .:.::..|  |:||.|||||||..|.:.|.| ||||||||||||||||||||||||||.||.:.|
  Fly    68 GTDNAGQV--AQGSFSYTSPEGIPIRITYLA-DENGFQPQGDHLPTPPPIPPAIQKALAYLATAP 129

  Fly   130 P 130
            |
  Fly   130 P 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AeNP_610774.3 Chitin_bind_4 43..101 CDD:278791 31/57 (54%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 31/57 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.