DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or19a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:430 Identity:84/430 - (19%)
Similarity:159/430 - (36%) Gaps:121/430 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MFKTLGYDLFHTP--KPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWES-----LAGSPSKIM 74
            :|:.:|   .|.|  :.:|.    |.|.....:.|      ||..|..|.|     |..:..:..
  Fly    18 IFRIMG---IHPPGKRTFWG----RHYTAYSMVWN------VTFHICIWVSFSVNLLQSNSLETF 69

  Fly    75 RQGL-----HFFYMLSSQLKFITFMINRKRL---LQLSHRLKELYPHKEQNQRKYEVNKYYLSCS 131
            .:.|     |..|||.        :||.:|:   :..||.|..|...:             |.|.
  Fly    70 CESLCVTMPHTLYMLK--------LINVRRMRGQMISSHWLLRLLDKR-------------LGCD 113

  Fly   132 TRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIF----------------------- 173
            ...        .::||             |..:|:|.::.||                       
  Fly   114 DER--------QIIMA-------------GIERAEFIFRTIFRGLACTVVLGIIYISASSEPTLM 157

  Fly   174 -PTRLTFD-SEKPLGYVLAYVIDFT----YSQFIVNVSL--GTDLWMMCVSSQISMHLGYLANML 230
             ||.:.:: .:....|:...::..|    .:..::|:|.  ||.|.:      :|:|...||..:
  Fly   158 YPTWIPWNWRDSTSAYLATAMLHTTALMANATLVLNLSSYPGTYLIL------VSVHTKALALRV 216

  Fly   231 ASI---RPSPETEQQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVV 292
            :.:   .|.|....|  ..|...|..||:::||.|.:.....:......|:|:|..|.:.|:.: 
  Fly   217 SKLGYGAPLPAVRMQ--AILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLL- 278

  Fly   293 EGFNWEGI----SYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILIL 353
              |...||    :.:.|...:..:..::....::......:|..|.:...|...|:.:::.:|::
  Fly   279 --FGNVGIMRFMNMLFLLVILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLM 341

  Fly   354 MAQAQRPLEISARGVII-ISLDTFKILMTITYRFFAVIRQ 392
            :|:.|.|: |...|||: ||:.||.:::...|....::.:
  Fly   342 LARCQIPM-ILVSGVIVPISMKTFTVMIKGAYTMLTLLNE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 64/337 (19%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 69/360 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.