DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or88a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:332 Identity:75/332 - (22%)
Similarity:133/332 - (40%) Gaps:52/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYFVMVVMAL-EPL 151
            ::.:...:.||.:::..:.|....|....:|...::::.|     ||....|.|:.:...| .|:
  Fly    92 IRGLMLYLKRKEIVEFVNDLDRECPRDLVSQLDMQMDETY-----RNFWQRYRFIRIYSHLGGPM 151

  Fly   152 VQSCIMYLIGF-----GKAD--FTYKRIFPTRLTFDSEK-PLGYVLAYVIDFTYSQFIVNVSLGT 208
            .  |::.|..|     ||..  ..::::....|.....| |..|:|.:..|...:...|:..:..
  Fly   152 F--CVVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDLMCTTCGVSFFVTF 214

  Fly   209 DLWMMCVSSQISMHLGYLANMLASIRPSPETEQQDCDF--LASIIKRHQLMIRLQKDVNYVFGL- 270
            |.....:...:.||||:||...::|.|......:...|  |..:::|.||:..|.:..|.:|.: 
  Fly   215 DNLFNVMQGHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFKVA 279

  Fly   271 LLASN-------------LFTTSCLLCCMAYY---TVVEGFNWEGISYMMLFASVAAQFYVVSSH 319
            .|.||             |..||.:|....|.   .|:.||.:|                 :...
  Fly   280 FLVSNFVGAGSLCFYLFMLSETSDVLIIAQYILPTLVLVGFTFE-----------------ICLR 327

  Fly   320 GQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITY 384
            |..|...|..|..:....:||.||.||:|..|:.....||..::.|.|:|.:::..|..:|.:.|
  Fly   328 GTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAY 392

  Fly   385 RFFAVIR 391
            |.|..::
  Fly   393 RLFTFLK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 72/323 (22%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 72/323 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.