DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or85f

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:398 Identity:126/398 - (31%)
Similarity:231/398 - (58%) Gaps:9/398 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKLR-SYEDFIFMANMMFKTLGYDLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWE 64
            ||.:: |||||..:...:|..:|||:...||...|.:|...|..||..|:.....::..|::|.:
  Fly     1 MEPVQYSYEDFARLPTTVFWIMGYDMLGVPKTRSRRILYWIYRFLCLASHGVCVGVMVFRMVEAK 65

  Fly    65 SLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLS 129
            :: .:.|.|||......|:::|..||.| ::.|..:..|:.:|.||||....::..:.||.:|.:
  Fly    66 TI-DNVSLIMRYATLVTYIINSDTKFAT-VLQRSAIQSLNSKLAELYPKTTLDRIYHRVNDHYWT 128

  Fly   130 CSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEK-PLG-YVLAYV 192
            .|...::.:|....:::.:.|::.|.|.|   |....|||...:|..| :|.|| |:. |:..|.
  Fly   129 KSFVYLVIIYIGSSIMVVIGPIITSIIAY---FTHNVFTYMHCYPYFL-YDPEKDPVWIYISIYA 189

  Fly   193 IDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANMLASIRPSPETEQQDCDFLASIIKRHQLM 257
            :::.:|..:|..::|.|:|::....||::|...:...||..:||.:.:|:|..|:|.|:.:...:
  Fly   190 LEWLHSTQMVISNIGADIWLLYFQVQINLHFRGIIRSLADHKPSVKHDQEDRKFIAKIVDKQVHL 254

  Fly   258 IRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASVAAQFYVVSSHGQM 322
            :.||.|:|.:||..|..:|.||:.::|.:|.||:::|...||.:|::...:...|.|:|..:||.
  Fly   255 VSLQNDLNGIFGKSLLLSLLTTAAVICTVAVYTLIQGPTLEGFTYVIFIGTSVMQVYLVCYYGQQ 319

  Fly   323 LIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFF 387
            ::|||..:|.|.:...:::.|:.||:.:||::.:||:|:|::|.|.:.|||||||.||:::||..
  Fly   320 VLDLSGEVAHAVYNHDFHDASIAYKRYLLIIIIRAQQPVELNAMGYLSISLDTFKQLMSVSYRVI 384

  Fly   388 AVIRQTVE 395
            .::.|.::
  Fly   385 TMLMQMIQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 96/297 (32%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 102/317 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472757
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.