DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or83c

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:430 Identity:89/430 - (20%)
Similarity:167/430 - (38%) Gaps:100/430 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLRSYEDFIFMANMMFKTLGYDLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRII----EW 63
            :.|....:|   |.:...||.| |.:||..:.|   |.:..:..|:|:...::.|  |:    :|
  Fly    10 RFRELSKYI---NSLTNLLGVD-FLSPKLKFNY---RTWTTIFAIANYTGFTVFT--ILNNGGDW 65

  Fly    64 ESLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYL 128
            .  .|..:.:|..||  |:.|.   ||:|.::..:.:.:|....:.:|...|.....|...   |
  Fly    66 R--VGLKASLMTGGL--FHGLG---KFLTCLLKHQDMRRLVLYSQSIYDEYETRGDSYHRT---L 120

  Fly   129 SCSTRNVLYV-------YYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLT-------- 178
            :.:...:|.:       |.|...:|.|.||  :.:||              ..||:|        
  Fly   121 NSNIDRLLGIMKIIRNGYVFAFCLMELLPL--AMLMY--------------DGTRVTAMQYLIPG 169

  Fly   179 FDSEKPLGYVLAYVIDFTYSQFIVNVSL-GTDLWMMCVSSQISMHLGYLANML-ASIRPSPETEQ 241
            ...|....||:.|:|. |.:..:..|.. ..||::....:||..    .|:|| ..::...:..:
  Fly   170 LPLENNYCYVVTYMIQ-TVTMLVQGVGFYSGDLFVFLGLTQILT----FADMLQVKVKELNDALE 229

  Fly   242 QDCDF-------------------LASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMA 287
            |..::                   |..:|:.|||.....:.:|.::..|:|:.:.  |..|..|.
  Fly   230 QKAEYRALVRVGASIDGAENRQRLLLDVIRWHQLFTDYCRAINALYYELIATQVL--SMALAMML 292

  Fly   288 YYTVVEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFES--------KWYEGSL 344
            .:.:          .:..|...:|.|:|||::...:..:...:.:.|::.        .|||.|.
  Fly   293 SFCI----------NLSSFHMPSAIFFVVSAYSMSIYCILGTILEFAYDQVYESICNVTWYELSG 347

  Fly   345 RYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITY 384
            ..:|....|:.::|.|..|...||:.:|:.|...::.:.|
  Fly   348 EQRKLFGFLLRESQYPHNIQILGVMSLSVRTALQIVKLIY 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 66/339 (19%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 71/358 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.