DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or83a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:459 Identity:81/459 - (17%)
Similarity:155/459 - (33%) Gaps:145/459 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FKTLGYDLFHTPKPWWRYLLVRGYFV--------LCTI--------SNFYEASMVTTRIIEWESL 66
            |..|.|:||:             |||        :|||        .:|:...::.|.|..|   
  Fly    51 FCDLTYELFN-------------YFVSVHIAGLYICTIYINYGQGDLDFFVNCLIQTIIYLW--- 99

  Fly    67 AGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLSCS 131
                            .::.:|.|..|   |..||               |.....:|..|   .
  Fly   100 ----------------TIAMKLYFRRF---RPGLL---------------NTILSNINDEY---E 127

  Fly   132 TRNVLYVYYFVMVVMA---------LEPLVQSCIMYLIGFGKADFTYK-RIFPTR--LTFDSEKP 184
            ||:.:   .|..|.||         ::..|..|.:..|.:......|: |..|..  ..||..:|
  Fly   128 TRSAV---GFSFVTMAGSYRMSKLWIKTYVYCCYIGTIFWLALPIAYRDRSLPLACWYPFDYTQP 189

  Fly   185 LGYVLAYVIDFTYSQFIVNVSLGTDL---WMMCV--SSQISMHLGYLANMLAS------------ 232
            ..|.:.:::. ...|..|..|..:..   .::||  |.|..:....|.|:|||            
  Fly   190 GVYEVVFLLQ-AMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTEL 253

  Fly   233 -----------IRP-------SPETEQQD-------CDFLASI-------IKRHQLMIRLQKDVN 265
                       :.|       ..||..|:       .||.::.       |:.|:.::...|.:.
  Fly   254 NQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLSFVRCIQHHRYIVAALKKIE 318

  Fly   266 YVFGLLLASNLFTTSCLLCCMAYY----TVVEGFNWEGIS---YMMLFASVAAQFYVVSSHGQML 323
            ..:..:....:...:.|:|.:|:.    |....| ...:|   |::|   |..:.:::.....::
  Fly   319 SFYSPIWFVKIGEVTFLMCLVAFVSTKSTAANSF-MRMVSLGQYLLL---VLYELFIICYFADIV 379

  Fly   324 IDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFA 388
            ...|....:|.:.|.|.......:.:.:..|..::|..:::|..:..:::|.|:..:|..:.|..
  Fly   380 FQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRFRGTITTAFSFLT 444

  Fly   389 VIRQ 392
            ::::
  Fly   445 LLQK 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 65/363 (18%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 49/289 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.