DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or71a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:308 Identity:61/308 - (19%)
Similarity:124/308 - (40%) Gaps:63/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LKELYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYF-----VMVVMALEPLVQSCIMYLIGFGKAD 166
            |.||...:|.:..::|..::       |.::::|.     |:..:.::||..             
  Fly   105 LFELRSKQEVDMWRFEHRRF-------NRVFMFYCLCSAGVIPFIVIQPLFD------------- 149

  Fly   167 FTYKRIFPTRL------TFDSEKPLGYVLAYVIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGY 225
                  .|.||      .||.::|:.:..|::    |....:.::...::.|..|:..:.:||..
  Fly   150 ------IPNRLPFWMWTPFDWQQPVLFWYAFI----YQATTIPIACACNVTMDAVNWYLMLHLSL 204

  Fly   226 LANMLASIRPSPETEQQDC--DFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFT---TSCLLCC 285
            ...||.......:.:.:|.  .|| .:|..||   ||::....: .:.::.:.||   .|.|:.|
  Fly   205 CLRMLGQRLSKLQHDDKDLREKFL-ELIHLHQ---RLKQQALSI-EIFISKSTFTQILVSSLIIC 264

  Fly   286 MAYYTV--------VEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEG 342
            ...|::        :.||    .:.|....::..|..:.:.:|..:||.:..|..:.:.|.|.:.
  Fly   265 FTIYSMQMSPVLQDLPGF----AAMMQYLVAMIMQVMLPTIYGNAVIDSANMLTDSMYNSDWPDM 325

  Fly   343 SLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVI 390
            :.|.::.:|:.|....||:.:.|.|...|.|..|...|...|...|::
  Fly   326 NCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 59/300 (20%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 59/300 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.