DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or67c

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster


Alignment Length:413 Identity:97/413 - (23%)
Similarity:192/413 - (46%) Gaps:46/413 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSYEDFIFMANMMFKTLGYDLF-HTPKPWWRYLLVRGY-------FVLCTISN---FYEA--SMV 56
            |::.:.:.:....::|:|.|:: |......:.||.:.|       |.|..|..   ||.:  ...
  Fly    10 RTFMELMRVPVQFYRTIGEDIYAHRSTNPLKSLLFKIYLYAGFINFNLLVIGELVFFYNSIQDFE 74

  Fly    57 TTRIIEWESLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKY 121
            |.|:    ::|.:|.        ..:.|.:..|....:..:|.|:.|...|:.::|.....|.:|
  Fly    75 TIRL----AIAVAPC--------IGFSLVADFKQAAMIRGKKTLIMLLDDLENMHPKTLAKQMEY 127

  Fly   122 EVNKYYLSCSTRNVLYVYYFVMV----VMALEPLVQSCIMY-LIGFGKAD--FTYKRIFPTRLTF 179
            ::..:  ..:.:.|:.::.|:.:    ..:..|.:::.:.: .:|:...|  |.:...||    |
  Fly   128 KLPDF--EKTMKRVINIFTFLCLAYTTTFSFYPAIKASVKFNFLGYDTFDRNFGFLIWFP----F 186

  Fly   180 DSEK-PLGYVLAYVIDFTYSQFIVNVS-LGTDLWMMCVSSQISMHLGYLANMLASIRPSPETEQQ 242
            |:.: .|.|.:.| .|..:..::..:: |..||.::.|.:||.||..|::..|.....:...:::
  Fly   187 DATRNNLIYWIMY-WDIAHGAYLAGIAFLCADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKE 250

  Fly   243 DCDFLASIIKRHQLMIRLQKDVN--YVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMML 305
            :.:||..||:.|...::|.:.||  |.|.|||  |....|..:|.:| :.|.|......|.|.:.
  Fly   251 NIEFLIGIIRYHDKCLKLCEHVNDLYSFSLLL--NFLMASMQICFIA-FQVTESTVEVIIIYCIF 312

  Fly   306 FASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVII 370
            ..:...|.::|..:|..||..|..:..||:..||::.|..|...:.:|:.::|:|..|.......
  Fly   313 LMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPP 377

  Fly   371 ISLDTFKILMTITYRFFAVIRQT 393
            |||.|:..:::::|:|||::|.|
  Fly   378 ISLVTYMKVISMSYQFFALLRTT 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 73/306 (24%)
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 74/314 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472788
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EMAZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.