DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or59c

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:321 Identity:55/321 - (17%)
Similarity:128/321 - (39%) Gaps:70/321 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ELYPHKEQNQRKYEVNKYYLSCSTRNVLY---VYYFVMVVMALEPLVQSCIMYLIGFGKADFTYK 170
            :::..:..|:....::|..::.:.|.:.:   ....::|::.|...:..|.:.|         :.
  Fly   106 QMWRFRRMNELISSLDKRCVTTTQRRIFHKMVARVNLIVILFLSTYLGFCFLTL---------FT 161

  Fly   171 RIFPTRLTFDSEKPL-----GY-------VLAYVIDFTYSQFIVNVSLGT------DLWMMCVSS 217
            .:|..:..:....||     |:       :|.|.:          ||:||      |.:.:...|
  Fly   162 SVFAGKAPWQLYNPLVDWRKGHWQLWIASILEYCV----------VSIGTMQELMSDTYAIVFIS 216

  Fly   218 QISMHLGYLANMLASIRPSPE-TEQQDCDFLASIIKRHQLMIRLQKDVNYV-------------- 267
            ....||..|.:.:|::|..|: :|.:..:.:.:.|:.|:.:|:..:.:..:              
  Fly   217 LFRCHLAILRDRIANLRQDPKLSEMEHYEQMVACIQDHRTIIQCSQIIRPILSITIFAQFMLVGI 281

  Fly   268 -FGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLA 331
             .||...|.||..:.:...||           .:|:::...:.:....::..|   ||:.|.:::
  Fly   282 DLGLAAISILFFPNTIWTIMA-----------NVSFIVAICTESFPCCMLCEH---LIEDSVHVS 332

  Fly   332 KAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVIRQ 392
            .|.|.|.|......||..:|..:.:||:|::.:|..:..||:.:...:....:....::.|
  Fly   333 NALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIVNQ 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 54/311 (17%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 54/311 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465969
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.