DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or56a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:453 Identity:80/453 - (17%)
Similarity:173/453 - (38%) Gaps:114/453 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SYEDFIFMANMMFKTLGYDLFHTPKPWWRYLLVRGY------FVLCTI---SNFYEASMVTTRII 61
            ::||.||..::.:       |.    |:.|:..:..      .:.|||   |.:...:::..|:.
  Fly    13 TFEDPIFGTHLRY-------FQ----WYGYVASKDQNRPLLSLIRCTILTASIWLSCALMLARVF 66

  Fly    62 E-WESLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKR---LLQLSHRLKELYPHKEQNQRKYE 122
            . :|:|....:.......:|    :..:......:.|.:   ||:::|...:...|:..| |:.|
  Fly    67 RGYENLNDGATSYATAVQYF----AVSIAMFNAYVQRDKVISLLRVAHSDIQNLMHEADN-REME 126

  Fly   123 V---NKYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFD---- 180
            :   .:.|    ||.:..:.:...|:..|             ...:|..|:.:|..:..|:    
  Fly   127 LLVATQAY----TRTITLLIWIPSVIAGL-------------MAYSDCIYRSLFLPKSVFNVPAV 174

  Fly   181 ---SEKPLGYVLAYVIDFTYSQFIVNVSLG--------------TDLW---MMCVSSQISMHLGY 225
               .|.|   :|.:.: |.:.:...|..:|              ..||   :.|:...:::.|..
  Fly   175 RRGEEHP---ILLFQL-FPFGELCDNFVVGYLGPWYALGLGITAIPLWHTFITCLMKYVNLKLQI 235

  Fly   226 LANMLASIRPSPETEQQDCDFLAS--IIKR-------------------HQLMIR-LQKDVNYVF 268
            |         :...|:.|...|.|  :|.|                   .||.|| ..:::.|:.
  Fly   236 L---------NKRVEEMDITRLNSKLVIGRLTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLI 291

  Fly   269 GLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFA---SVAAQFYVVSSHGQMLIDLSTNL 330
            .:.:.::....|.|:|.: ::.:..|.. ..:.|..:|.   .:|...::...|..::::....|
  Fly   292 CVPVMADFIIFSVLICFL-FFALTVGVP-SKMDYFFMFIYLFVMAGILWIYHWHATLIVECHDEL 354

  Fly   331 AKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVIRQT 393
            :.|.|...||...:..:|.::.:|..||||:::.|. ::.::|.||..:....|.:|.::|.:
  Fly   355 SLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRAL-LVDLNLRTFIDIGRGAYSYFNLLRSS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 62/350 (18%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 55/313 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.