DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or47a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster


Alignment Length:432 Identity:87/432 - (20%)
Similarity:169/432 - (39%) Gaps:99/432 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EDFIFMANMMFKTLGYDLFHTPKPWWRYLLVRGY-----FVLCTISNFYEASMVTTRIIEWES-- 65
            :.|:.:.......||:|||...:..|:    |.|     |.:..|..|..|::    :..|::  
  Fly     2 DSFLQVQKSTIALLGFDLFSENREMWK----RPYRAMNVFSIAAIFPFILAAV----LHNWKNVL 58

  Fly    66 -LAGSPSKIMRQ--GLHFFYMLSSQLKFITFMINRKRLLQLSHRLKE-------LYPHKEQNQRK 120
             ||.:...::..  ||..|.|:....:....:|::.||| :|:..::       |....:|:||.
  Fly    59 LLADAMVALLITILGLFKFSMILYLRRDFKRLIDKFRLL-MSNEAEQGEEYAEILNAANKQDQRM 122

  Fly   121 YEVNK--YYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMY-LIGFGKADFTYKRIFPTRLTFDSE 182
            ..:.:  :.|:.:..:||             |||:..:.| |.|..:.:..:..:||..:..   
  Fly   123 CTLFRTCFLLAWALNSVL-------------PLVRMGLSYWLAGHAEPELPFPCLFPWNIHI--- 171

  Fly   183 KPLGYVLAYVIDFTYSQF------IVNVSLGTDLWMMCVSSQISMHLGYLANMLA---------- 231
                 :..||:.|.:|.|      :..|||.|   :.|         .:.:|:.|          
  Fly   172 -----IRNYVLSFIWSAFASTGVVLPAVSLDT---IFC---------SFTSNLCAFFKIAQYKVV 219

  Fly   232 -----SIRPSPETEQQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTV 291
                 |::.|..|       |..:...:|..:.:..|:|..:..::.:..|.:|..||.:.|...
  Fly   220 RFKGGSLKESQAT-------LNKVFALYQTSLDMCNDLNQCYQPIICAQFFISSLQLCMLGYLFS 277

  Fly   292 VEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYE------GSLRYKKEI 350
            :.....||:.|....|::..|.|:....|:.|...|.:...|.::|.|:|      .|....:.:
  Fly   278 ITFAQTEGVYYASFIATIIIQAYIYCYCGENLKTESASFEWAIYDSPWHESLGAGGASTSICRSL 342

  Fly   351 LILMAQAQRPLEISARGVII-ISLDTFKILMTITYRFFAVIR 391
            ||.|.:|.|...|:  |... .:::.|..::.....:..::|
  Fly   343 LISMMRAHRGFRIT--GYFFEANMEAFSSIVRTAMSYITMLR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 66/333 (20%)
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 72/361 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.