DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or43a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster


Alignment Length:402 Identity:83/402 - (20%)
Similarity:154/402 - (38%) Gaps:77/402 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LFHTPKPWWRYLLVRGYFVL-CTISNFYEASMVTTRIIEWESLAGSPSKIMRQGLHFFYMLSSQL 88
            |:.||...||    :..||| .|..|..:...:   :..|..|   |:.|:  .:.||..:.:.|
  Fly    22 LYPTPGSSWR----KFAFVLPVTAMNLMQFVYL---LRMWGDL---PAFIL--NMFFFSAIFNAL 74

  Fly    89 KFITFMINRKR--------LLQLSHRL--------KELYPHKEQNQRKYEVNKYYLSCSTRNVLY 137
            .....:|.::|        |..|.|.:        :.:....|:..|...:  ..||.|      
  Fly    75 MRTWLVIIKRRQFEEFLGQLATLFHSILDSTDEWGRGILRRAEREARNLAI--LNLSAS------ 131

  Fly   138 VYYFVMVVMAL-EPLVQSCIMYLIGFGKADFTYKRIFPTRLTFD----SEKPLGYVLAY------ 191
               |:.:|.|| .||               |..:|..|..|...    :..|: |.:.|      
  Fly   132 ---FLDIVGALVSPL---------------FREERAHPFGLALPGVSMTSSPV-YEVIYLAQLPT 177

  Fly   192 --VIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANMLASIRPSPETEQQDCDFLASIIKRH 254
              ::...|..| |::..|..::...:       |..|.:.|..|....::|::....|||.|..|
  Fly   178 PLLLSMMYMPF-VSLFAGLAIFGKAM-------LQILVHRLGQIGGEEQSEEERFQRLASCIAYH 234

  Fly   255 QLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASVAAQFYVVSSH 319
            ..::|....:|.:...::|........::|.:.:...:.....:.||.:|...::....:...:.
  Fly   235 TQVMRYVWQLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQVISIVMYILTMLYVLFTYYNR 299

  Fly   320 GQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITY 384
            ...:...:..:|:|.:...|||...|::|.:||.:.|.|.|:||....|..::|..|:.|:..:|
  Fly   300 ANEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASY 364

  Fly   385 RFFAVIRQTVEK 396
            .:|.::|....|
  Fly   365 SYFTMLRGVTGK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 63/324 (19%)
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 68/347 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.