DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or42a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster


Alignment Length:421 Identity:79/421 - (18%)
Similarity:164/421 - (38%) Gaps:79/421 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRSYEDFIFMANMMFKTLGYDLFHTPKPWWRYLL--VRGYFVLCTISNFYEASMVTTRIIEWESL 66
            :||.:..:::...:|      |....||..::.:  |...|.|...|.||:.....|..|...| 
  Fly    19 VRSRDATLYLLRCVF------LMGVRKPPAKFFVAYVLWSFALNFCSTFYQPIGFLTGYISHLS- 76

  Fly    67 AGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLSCS 131
            ..||.:.:......|...|...|.:......||..:.::.|.|:.........:.:::: .:|.|
  Fly    77 EFSPGEFLTSLQVAFNAWSCSTKVLIVWALVKRFDEANNLLDEMDRRITDPGERLQIHR-AVSLS 140

  Fly   132 TRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTY-KRIFPTRLTFDSEKPLGYVLAYVIDF 195
            .|    :::|.|.|            |::   .|..|: ..||..|..:.:..|.       :|:
  Fly   141 NR----IFFFFMAV------------YMV---YATNTFLSAIFIGRPPYQNYYPF-------LDW 179

  Fly   196 TYSQFIVNVSLGTDLWMM--------CVSSQ-------ISMHLGYLANMLASIRPSP-ETEQQDC 244
            ..|...:.:..|.:.:.|        ||...       :..|:...|..|..:...| |:::|..
  Fly   180 RSSTLHLALQAGLEYFAMAGACFQDVCVDCYPVNFVLVLRAHMSIFAERLRRLGTYPYESQEQKY 244

  Fly   245 DFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASV 309
            :.|...|:.|::::|....:..|    ::..:|....::..:..:|::.         ::|||::
  Fly   245 ERLVQCIQDHKVILRFVDCLRPV----ISGTIFVQFLVVGLVLGFTLIN---------IVLFANL 296

  Fly   310 AAQFYVVSSHGQMLIDLST-------------NLAKAAFESKWYEGSLRYKKEILILMAQAQRPL 361
            .:....:|....:|::.:.             .||.|.|:|.|.:...||:|.::..:.:.|:|:
  Fly   297 GSAIAALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQSNWIDEEKRYQKTLMYFLQKLQQPI 361

  Fly   362 EISARGVIIISLDTFKILMTITYRFFAVIRQ 392
            ...|..|..||:.|...:...::..|.:::|
  Fly   362 TFMAMNVFPISVGTNISVTKFSFSVFTLVKQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 58/325 (18%)
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 62/344 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.