DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or35a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:438 Identity:72/438 - (16%)
Similarity:165/438 - (37%) Gaps:118/438 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IFMANMMFKTLGYDLFHTPKPWWRYL---------LVRGYFVLCTISNFYEASMVTTRIIEWES- 65
            :|..|.:|    :.|..:...|.|||         ||           |.:.:....|.:.:|: 
  Fly    22 VFRLNHIF----WPLDPSTGKWGRYLDKVLAVAMSLV-----------FMQHNDAELRYLRFEAS 71

  Fly    66 -------LAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRL---LQLSHRLKELYPHKEQNQRK 120
                   |.|.|:        :..::.:|.:.:..:::.::|   |::.:....:.|.||....:
  Fly    72 NRNLDAFLTGMPT--------YLILVEAQFRSLHILLHFEKLQKFLEIFYANIYIDPRKEPEMFR 128

  Fly   121 YEVNKYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPL 185
            ....|..::   |.|..:|..|:.:..:.|     :..:|...| ||.|..|||    |||: ||
  Fly   129 KVDGKMIIN---RLVSAMYGAVISLYLIAP-----VFSIINQSK-DFLYSMIFP----FDSD-PL 179

  Fly   186 GYVLAYVIDFTYSQFIVNVSLGTDLWMMCVSSQISMHL--GYL---------ANMLASIRPSPET 239
            ...:..::...:...:::..:..:..::|   ::.:||  .|:         ...:...|..|..
  Fly   180 YIFVPLLLTNVWVGIVIDTMMFGETNLLC---ELIVHLNGSYMLLKRDLQLAIEKILVARDRPHM 241

  Fly   240 EQQDCDFLASIIKRHQLMIRL--QKDVNYVFGLLLASNLFTTSC-LLCCMAY-----------YT 290
            .:|....:...::::..:.:.  |.:..|...:.:   :|..:. |||.:::           |.
  Fly   242 AKQLKVLITKTLRKNVALNQFGQQLEAQYTVRVFI---MFAFAAGLLCALSFKAYTNPMANYIYA 303

  Fly   291 VVEGFNWEGISYMMLFA-------------SVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEG 342
            :     |.|...:.|.:             |::..:|:  :|.:.::..|||.::          
  Fly   304 I-----WFGAKTVELLSLGQIGSDLAFTTDSLSTMYYL--THWEQILQYSTNPSE---------- 351

  Fly   343 SLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVI 390
            :||..|.|.:.:....:|..::......:||.....::..::.:|..:
  Fly   352 NLRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 54/336 (16%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 58/363 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.