DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or33b

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster


Alignment Length:414 Identity:81/414 - (19%)
Similarity:145/414 - (35%) Gaps:99/414 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEW-----------ESLAGSPSKIMRQG 77
            |::.|...:|..|.:...|.|..:.:.    ::|..:..|           |...|...|    |
  Fly    12 DIYRTYWLYWHLLGLESNFFLNRLLDL----VITIFVTIWYPIHLILGLFMERSLGDVCK----G 68

  Fly    78 LH-----FFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLSCSTRNVLY 137
            |.     ||    :..|||.|......:.::....|||    :|.....|..:::...:.|...:
  Fly    69 LPITAACFF----ASFKFICFRFKLSEIKEIEILFKEL----DQRALSREECEFFNQNTRREANF 125

  Fly   138 VYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAYVIDFTYSQFIV 202
            ::...:|...|.. :.:....|.|.|     :|.::|....:|.:   ...|.:.:..||.  |.
  Fly   126 IWKSFIVAYGLSN-ISAIASVLFGGG-----HKLLYPAWFPYDVQ---ATELIFWLSVTYQ--IA 179

  Fly   203 NVS------LGTDLWMMCVSSQISMHLGYLANMLASIRPSPE-----TEQQDCDFLASIIKRHQL 256
            .||      |..|.:.......::.|:..||..|:.|...||     |.:|    |...|:.|:.
  Fly   180 GVSLAILQNLANDSYPPMTFCVVAGHVRLLAMRLSRIGQGPEETIYLTGKQ----LIESIEDHRK 240

  Fly   257 MIRLQK---------------------DVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGI 300
            ::::.:                     .:..|..|..|.|.|       .:.||.|         
  Fly   241 LMKIVELLRSTMNISQLGQFISSGVNISITLVNILFFADNNF-------AITYYGV--------- 289

  Fly   301 SYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISA 365
                .|.|:..:.:....:|.::......|..|.:.|.|...:..|.:.:||.|......::|.|
  Fly   290 ----YFLSMVLELFPCCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEVQIKA 350

  Fly   366 RGVIIISLDTFKILMTITYRFFAV 389
            .|:|.|.::.|...:.:.|.||.:
  Fly   351 GGMIGIGMNAFFATVRLAYSFFTL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 63/327 (19%)
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 69/354 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.