DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or33a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:390 Identity:83/390 - (21%)
Similarity:153/390 - (39%) Gaps:42/390 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KTLGYDLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWESLAG---SPSKIMRQGLHF 80
            |....:|:.|...:||.|.|.|.:....:.:|...|.:|. :.....:.|   .|...:.:.|||
  Fly     6 KVRSENLYKTYWLYWRLLGVEGDYPFRRLVDFTITSFITI-LFPVHLILGMYKKPQIQVFRSLHF 69

  Fly    81 -FYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYFVMV 144
             ...|....||..|....|.:..:...|::|....|.     |..:.|.:.:...|..:.....:
  Fly    70 TSECLFCSYKFFCFRWKLKEIKTIEGLLQDLDSRVES-----EEERNYFNQNPSRVARMLSKSYL 129

  Fly   145 VMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAYVIDFTY----SQFIVNVS 205
            |.|:..::.:.:..|...|: :..|...||    :|.:   .....|.|.|:|    |..::..:
  Fly   130 VAAISAIITATVAGLFSTGR-NLMYLGWFP----YDFQ---ATAAIYWISFSYQAIGSSLLILEN 186

  Fly   206 LGTDLWMMCVSSQISMHLGYLANMLASI------RPSPETEQ-----QDCDFLASIIKRHQLMIR 259
            |..|.:.......:|.|:..|...|:.|      ..|..|.:     ||...|..||:..:..:.
  Fly   187 LANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKLMKIIRLLRSTLH 251

  Fly   260 LQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASVAAQFYVVSSHGQMLI 324
            |.:     .|..|:|.:..:..|:..:.:   .|. |:..:.|.:.||::..:.:....:|.::.
  Fly   252 LSQ-----LGQFLSSGINISITLINILFF---AEN-NFAMLYYAVFFAAMLIELFPSCYYGILMT 307

  Fly   325 DLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAV 389
            .....|..|.|.|.|.:...||.:.::|||.....|:.|.|.|::.|.:..|...:.:.|.|:.:
  Fly   308 MEFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTL 372

  Fly   390  389
              Fly   373  372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 64/310 (21%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 68/327 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.