DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or24a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:388 Identity:82/388 - (21%)
Similarity:163/388 - (42%) Gaps:57/388 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 WRYLLVRGYFVL---CTISNFYEASMVTTRI-IEWESLAGSPSKIMRQGLHFFYMLSSQLKFITF 93
            |.:.   .:|:|   |....:|....:...| ...::|....|.|:           |.:|.:..
  Fly    42 WSFF---NFFILTYGCYAEAYYGIHYIPINIATALDALCPVASSIL-----------SLVKMVAI 92

  Fly    94 MINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMY 158
            ...:..|..|..|::.| ..:::::||....|.:.:.:|:     ..|:::...........:.:
  Fly    93 WWYQDELRSLIERVRFL-TEQQKSKRKLGYKKRFYTLATQ-----LTFLLLCCGFCTSTSYSVRH 151

  Fly   159 LIG------FGKADFTY----KRIFPTRLTFDSEKPLGYVLAY------VIDFTYSQ-FIVNVSL 206
            ||.      .|| |:.|    |.:||..|......|:.|:|.:      |:.|..:. |.:...|
  Fly   152 LIDNILRRTHGK-DWIYETPFKMMFPDLLLRLPLYPITYILVHWHGYITVVCFVGADGFFLGFCL 215

  Fly   207 GTDLWMMCVSSQISMHLGYLANMLASIRPSPETEQQDCDFLASIIKRHQLMIRLQKDVNYVFGLL 271
            ...:.::|:...: ..|..:.|:..|  ||...|.:....:..::.||..:..|.:.::   |::
  Fly   216 YFTVLLLCLQDDV-CDLLEVENIEKS--PSEAEEARIVREMEKLVDRHNEVAELTERLS---GVM 274

  Fly   272 LASNL--FTTSCLLCCMAYYTVVEGFNWEG---ISYMMLFASVAAQFYVVSSHGQMLIDLSTNLA 331
            :...|  |.||.|:...   :||:...:.|   |.|::...:|..:.::....|..:::..:|||
  Fly   275 VEITLAHFVTSSLIIGT---SVVDILLFSGLGIIVYVVYTCAVGVEIFLYCLGGSHIMEACSNLA 336

  Fly   332 KAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVIRQTV 394
            ::.|.|.||..|:|.:|..|:::|:|||.|.|.. .....||:|...::..|....|:.:..:
  Fly   337 RSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKI-PFFSPSLETLTSILRFTGSLIALAKSVI 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 70/317 (22%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 75/347 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.