DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or23a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:430 Identity:85/430 - (19%)
Similarity:154/430 - (35%) Gaps:121/430 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KTLGYDLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWES----LAGSPSKIMRQGLH 79
            :||..|.|......||         :|...:..|.     |...|..    |...|:.::.:|::
  Fly     5 ETLKIDYFRVQLNAWR---------ICGALDLSEG-----RYWSWSMLLCILVYLPTPMLLRGVY 55

  Fly    80 FF--------------YMLSSQLKFITFMINRKRLLQLSHRLKEL---YPHKEQNQRKYEVNKYY 127
            .|              ..||:.:||..::....:::::...:.:|   ...:.|::|...:.::.
  Fly    56 SFEDPVENNFSLSLTVTSLSNLMKFCMYVAQLTKMVEVQSLIGQLDARVSGESQSERHRNMTEHL 120

  Fly   128 LSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLT--------FDSE-- 182
            |..|  .:..:.|.|:.::|..|.|                    |.|.|:        ||.:  
  Fly   121 LRMS--KLFQITYAVVFIIAAVPFV--------------------FETELSLPMPMWFPFDWKNS 163

  Fly   183 ----------KPLGYVLAYVIDFTYSQFIVNVSLGTDLWMMCVSSQISM------HLGYLANMLA 231
                      :.:|||...:..|....|       ..|.:..:|.|..:      .:||....| 
  Fly   164 MVAYIGALVFQEIGYVFQIMQCFAADSF-------PPLVLYLISEQCQLLILRISEIGYGYKTL- 220

  Fly   232 SIRPSPETEQQDCDFLASIIKRHQLMIRL----QKDVNY-------VFGLLLASNLFTTSCLLCC 285
                  |..:||   |.:.|:....:.||    :..|:|       |.|:.:|..||.       
  Fly   221 ------EENEQD---LVNCIRDQNALYRLLDVTKSLVSYPMMVQFMVIGINIAITLFV------- 269

  Fly   286 MAYYTVVEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEI 350
            :.:|  ||.. ::.|.|:.....:..|.|.:..:|.|:.:....|..|.|.|.|.:.|..|:..:
  Fly   270 LIFY--VETL-YDRIYYLCFLLGITVQTYPLCYYGTMVQESFAELHYAVFCSNWVDQSASYRGHM 331

  Fly   351 LILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVI 390
            |||..:.:|...:.|..::.|.|.|:.......|.||.::
  Fly   332 LILAERTKRMQLLLAGNLVPIHLSTYVACWKGAYSFFTLM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 66/335 (20%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 68/354 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.