DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or22c

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:385 Identity:70/385 - (18%)
Similarity:143/385 - (37%) Gaps:58/385 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KPWWRYLLVRGYFVLCTISNFYEASM----VTTRIIEWESLAGSPSKIMRQGLHFFYMLSSQLKF 90
            :||..:||....|.:..:....|.|.    :...::..|:.....:|.:           ..||.
  Fly    37 RPWHAHLLFVFAFAMVVVGAVGEVSYGCVHLDNLVVALEAFCPGTTKAV-----------CVLKL 90

  Fly    91 ITFMINRKRLLQLSHRLKE-LYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYF-----VMVVMALE 149
            ..|..:.:|..:|..||:. |:..:.|..::..|.    ..:|.|.|.:...     ......|:
  Fly    91 WVFFRSNRRWAELVQRLRAILWESRRQEAQRMLVG----LATTANRLSLLLLSSGTATNAAFTLQ 151

  Fly   150 PLVQSCIMYLIGF-GKADFTYKRIFPTRLTFDSEKPLGYVL--------AYVIDFTYSQFIVNVS 205
            ||:.....:::.. |:.:..:..|.|:........||.|||        .:...|....||.:. 
  Fly   152 PLIMGLYRWIVQLPGQTELPFNIILPSFAVQPGVFPLTYVLLTASGACTVFAFSFVDGFFICSC- 215

  Fly   206 LGTDLWMMCVSSQISMHLGYLANMLASIRPSPETEQQDCDF---LASIIKRHQLMIRLQKDVNYV 267
                |::......:...:..:...|........||:.:.:.   ||.:::||..:|....|:...
  Fly   216 ----LYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQ 276

  Fly   268 FGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAK 332
            |.:::..:..:.:.:||......::...:..|::|:....:...|.::....|..:.:.|..:|.
  Fly   277 FTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGNHVSESSAAVAD 341

  Fly   333 AAFESKWYEGSLRYKKEILILMAQAQRPLEI----------------SARGVIIISLDTF 376
            ..::.:||:...|.:|.||:::.::||...|                |..|..|..|.||
  Fly   342 VLYDMEWYKCDARTRKVILMILRRSQRAKTIAVPFFTPSLPALRSILSTAGSYITLLKTF 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 61/323 (19%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 58/342 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.