DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or22a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster


Alignment Length:416 Identity:86/416 - (20%)
Similarity:163/416 - (39%) Gaps:67/416 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKLRSYEDFIFMANMMFKTLGYDLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWESL 66
            |:::|.:.||::..:|: :.|:    |.....|::|.            |:..:....|:   .|
  Fly    16 ERVKSRDAFIYLDRVMW-SFGW----TEPENKRWILP------------YKLWLAFVNIV---ML 60

  Fly    67 AGSPSKIMRQGLHFF----------------YMLSSQLKFITFMINRKRLLQLSHRLKELYPHKE 115
            ...|..|..:.||.|                .|..|..|....:|..|:..:....|.:|.....
  Fly    61 ILLPISISIEYLHRFKTFSAGEFLSSLEIGVNMYGSSFKCAFTLIGFKKRQEAKVLLDQLDKRCL 125

  Fly   116 QNQRKYEVNKYYLSCSTRNVLY-VYYFVMVVMALEPLVQSCIMYLIGFGKADFTY---KRIFPTR 176
            .::.:..|::|....:..::|| ::|...|||                   :|.|   :|....|
  Fly   126 SDKERSTVHRYVAMGNFFDILYHIFYSTFVVM-------------------NFPYFLLERRHAWR 171

  Fly   177 LTF---DSEKPLGYVLAYVIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANMLASIRPSP- 237
            :.|   ||::.. |:.:....|..::.|. :.|.||:..:........|:..|...|.::|..| 
  Fly   172 MYFPYIDSDEQF-YISSIAECFLMTEAIY-MDLCTDVCPLISMLMARCHISLLKQRLRNLRSKPG 234

  Fly   238 ETEQQDCDFLASIIKRHQLMIRLQKDVNYVF-GLLLASNLFTTSCLLCCMAYYTVVEGFNWEGIS 301
            .||.:..:.|...|:.|:|::.....:..|| |.:....|...:.|...|........| |.|::
  Fly   235 RTEDEYLEELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLIGTVLGLSMINLMFFSTF-WTGVA 298

  Fly   302 YMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISAR 366
            ..:....|:.:.:.......|:||....::...|:|.|.....|||..::..:...|:|:.::|.
  Fly   299 TCLFMFDVSMETFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPITLTAG 363

  Fly   367 GVIIISLDTFKILMTITYRFFAVIRQ 392
            ||..||:.|...::.:.:....||:|
  Fly   364 GVFPISMQTNLAMVKLAFSVVTVIKQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 64/304 (21%)
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 66/321 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466008
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.