DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or10a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:437 Identity:94/437 - (21%)
Similarity:169/437 - (38%) Gaps:106/437 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FIFMANMMFKTLGYDLFHTPKPW-WRYLLVRGYFVLCTIS---------NFYEASMVTTRIIEWE 64
            |..:..:....:||....|...| ||.|:   :|.:..|.         .|.:...:|..:   |
  Fly    18 FFAVPRLSLDIMGYWPGKTGDTWPWRSLI---HFAILAIGVATELHAGMCFLDRQQITLAL---E 76

  Fly    65 SL--AGSPSKIMRQGLHFFYMLS---------SQLKFITFMINRKRLLQLSHRLKELYPHKEQNQ 118
            :|  ||:.:..:   |..|.||.         ::|:.:.|..|.:|..|...|||    |.....
  Fly    77 TLCPAGTSAVTL---LKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLK----HSAMAA 134

  Fly   119 RKYEVNKYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYL-------IGFGKADFTYKRI---- 172
            |   :|.:.||..        :|......|:|::.:.|:||       :.|...:.|..::    
  Fly   135 R---INFWPLSAG--------FFTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMPKVLLNY 188

  Fly   173 --FPTRLTFDSEKPLGYVLAYVI---DFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANMLAS 232
              ||  ||:......|||..::.   |..|.:|..::|...::....:.|....:..:|      
  Fly   189 PFFP--LTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHL------ 245

  Fly   233 IRPSPE----TEQQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYY---T 290
             ..||.    .||:    :.|:|.||..:|.|             :..|.....:..:|::   .
  Fly   246 -ELSPVQLYILEQK----MRSVIIRHNAIIDL-------------TRFFRDRYTIITLAHFVSAA 292

  Fly   291 VVEGFNW--------EGISYMMLFA-SVAA--QFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSL 344
            :|.||:.        .|:..|:..| :|||  |..|....|.::.:.||.|.:|.|...|.....
  Fly   293 MVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKP 357

  Fly   345 RYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVIR 391
            :.::.:.:|:.::|||:.: |......||.||..::..:....|:::
  Fly   358 KQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSIIALVK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 73/329 (22%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 82/373 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.