DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or9a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:401 Identity:73/401 - (18%)
Similarity:160/401 - (39%) Gaps:59/401 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MMFKTLGYDLFH----TPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWESLAGSPSKIMRQ 76
            ::::.:|.||:.    ..:||..::.: |...|..:..|..|....|::.......||.      
  Fly    22 LVYRCMGIDLWSPTMANDRPWLTFVTM-GPLFLFMVPMFLAAHEYITQVSLLSDTLGST------ 79

  Fly    77 GLHFFYMLSSQLKFITFMINRKRLLQLSHRLK-------ELYPH-----KEQNQRKYEVNKYYLS 129
                |..:.:.:||:.|..:||..:.|.:.::       |::|.     :.:||....::..|..
  Fly    80 ----FASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIEVENQSDQMLSLTYTR 140

  Fly   130 CSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFG-KADFTYKRIFPTRLTFDSEKPLGYVLAYVI 193
            |        :....:..||:|.|...:..:.|.. ..:..:..::|    :|.:..:.||..|:.
  Fly   141 C--------FGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYP----YDLQVVMFYVPTYLW 193

  Fly   194 DFTYSQFIVNVSLGTD------LWMMCVSSQISMHLGYLANMLASIRPSPETEQQDCDFLASIIK 252
            :...|...|.::|..|      .:.:|...:|:.|        ..|.......:::.:.|..::.
  Fly   194 NVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKH--------RMIHLPAVGGKEELEGLVQVLL 250

  Fly   253 RHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGF-NWEGISYMMLFASVAAQFYVV 316
            .||..:::...:...:..|:....| .|.|..|...:.|.:.| |.:.:.::....|:....::.
  Fly   251 LHQKGLQIADHIADKYRPLIFLQFF-LSALQICFIGFQVADLFPNPQSLYFIAFVGSLLIALFIY 314

  Fly   317 SSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVII-ISLDTFKILM 380
            |..|:.:...|.:.....:|:.|.:.|...|:.:||...:||||.::  :|... .|:.||..::
  Fly   315 SKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQM--KGYFFEASMATFSTIV 377

  Fly   381 TITYRFFAVIR 391
            .....:..::|
  Fly   378 RSAVSYIMMLR 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 59/316 (19%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 62/345 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.