DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or82a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:320 Identity:67/320 - (20%)
Similarity:133/320 - (41%) Gaps:45/320 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 FYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKY--------EVNK--------YYLS 129
            |..:.:.:|..||:.|||...::.||.::::.....:..:|        |.||        |.:|
  Fly    69 FTNMLTVIKISTFLANRKDFWEMIHRFRKMHEQSASHIPRYREGLDYVAEANKLASFLGRAYCVS 133

  Fly   130 CSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTF---DSEKPLGYVLAY 191
            |....:    ||:     |.|:|:..:....|     .|..:..|..:.|   |.|.| ||.:.:
  Fly   134 CGLTGL----YFM-----LGPIVKIGVCRWHG-----TTCDKELPMPMKFPFNDLESP-GYEVCF 183

  Fly   192 VIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANMLASIR-PSPETEQQDCDFLASIIKRHQ 255
            :.....:..:|..:...|...:..:..:..|...|...:.:.. ||.|.:.|  ..|.||::.|.
  Fly   184 LYTVLVTVVVVAYASAVDGLFISFAINLRAHFQTLQRQIENWEFPSSEPDTQ--IRLKSIVEYHV 246

  Fly   256 LMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFA----SVAAQFYVV 316
            |::.|.:.:..::...:......||..:..:.|..|.   |.:.:..::|:|    |:..|.::.
  Fly   247 LLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIYQLVT---NMDSVMDLLLYASFFGSIMLQLFIY 308

  Fly   317 SSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTF 376
            ...|:::...|..:..|...|.|:..|.:.:..:.:::.|:|:.:.|.| |..:.||..|
  Fly   309 CYGGEIIKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRA-GFFVASLANF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 66/313 (21%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 67/320 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.