DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or65b

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster


Alignment Length:337 Identity:65/337 - (19%)
Similarity:125/337 - (37%) Gaps:87/337 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 QLSHRLKELYP--HKEQNQRKYEVNKYYLSCSTRNVLYVYYFVMVVMALEPLVQS-----CIMYL 159
            |:...|..|:|  .|..|..:|:..|.            :||||...    |..|     ||:.|
  Fly   114 QVISDLDALHPWAQKGPNPVEYQTGKR------------WYFVMAFF----LATSWSFFLCILLL 162

  Fly   160 IGFGKADFTYKRIFPTRLTF------DSEKPLGYVLAYVIDFTYSQFIVNVSLGTDLWMMCVSSQ 218
            :......:.:::..|....|      .|..|:.:.:.|:....::.:.:...|..:...:|:.::
  Fly   163 LLITSPMWVHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSICIYAE 227

  Fly   219 ISMHLGYLANMLASIRP--------SPETEQQDCDFLASIIKRHQLMIRLQKDVNYVF-GLLLAS 274
            |:..:..|...|..|..        ..||.:        ::|.||.::.:....|.|| |.|:  
  Fly   228 ITFGIEVLCLELRQIHRHNYGLQELRMETNR--------LVKLHQKIVEILDRTNDVFHGTLI-- 282

  Fly   275 NLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFA-------SVAAQFYVV-----------SSHGQ 321
                            :..|.|:..:|..:|.|       .|.|||.|:           |..|.
  Fly   283 ----------------MQMGVNFSLVSLSVLEAVEARKDPKVVAQFAVLMLLALGHLSMWSYCGD 331

  Fly   322 MLIDLSTNLAKAAFESKWYE---GSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTIT 383
            .|...|..:::||:|:  |:   ||....:::.:::.:.|.||.:.|......:|..:..::...
  Fly   332 QLSQKSLQISEAAYEA--YDPTKGSKDVYRDLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQC 394

  Fly   384 YRFFAVIRQTVE 395
            |.....:.:|::
  Fly   395 YGILTFLLKTLD 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 63/324 (19%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 63/324 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.