DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or65a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:383 Identity:70/383 - (18%)
Similarity:144/383 - (37%) Gaps:73/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RIIEWE----------------SLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSH-- 105
            ||:.|:                .::.|...|:..|....::::  :.||.|     ||:..:.  
  Fly    62 RIVAWQYFVSIQLATALASLFYGISESIGDIVNLGRDLVFIIT--IIFICF-----RLVFFAQYA 119

  Fly   106 --------RLKELYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYFVMVV-----MALEPLVQSCIM 157
                    .|:::|....:.....||.:      |:.:.::.:..:::     :.|..|::....
  Fly   120 GELDVIIDALEDIYHWSIKGPATKEVQE------TKRLHFLLFMALIITWFSFLILFMLIKISTP 178

  Fly   158 YLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAYVIDFTYSQFI-----VNVSLGTDLWMMCVSS 217
            :.|......|...  :|.:|...|:.|:.|::.:|...|...:.     |..::|..|:....|:
  Fly   179 FWIESQTLPFHVS--WPFQLHDPSKHPIAYIIIFVSQSTTMLYFLIWLGVVENMGVSLFFELTSA 241

  Fly   218 QISMHLGYLANMLASIRPSPETEQQDCDF----LASIIKRHQLMIRLQKDVNYVF-GLLLASNLF 277
                    |..:...:|...|....|.|.    |..:.|.||.:|.|....|::| |..:...|.
  Fly   242 --------LRVLCIELRNLQELCLGDEDMLYRELCRMTKFHQQIILLTDRCNHIFNGAFIMQMLI 298

  Fly   278 TTSCLLCCMAYYTVVEGFN--WEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWY 340
              :.||..::.:.|:....  ...:.||::...........|..|.|....|..:|.|.:|:  |
  Fly   299 --NFLLVSLSLFEVLAAKKNPQVAVEYMIIMLMTLGHLSFWSKFGDMFSKESEQVALAVYEA--Y 359

  Fly   341 E---GSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVIRQTVE 395
            :   ||....::....:.:||:||.:.|......:|:.:..::...|....::..|:|
  Fly   360 DPNVGSKSIHRQFCFFIQRAQKPLIMKASPFPPFNLENYMFILKQCYSILTILANTLE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 61/325 (19%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 53/280 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.