DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49a and Or69a

DIOPT Version :9

Sequence 1:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:338 Identity:75/338 - (22%)
Similarity:129/338 - (38%) Gaps:63/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LHFFYMLSSQLKFITFMINRKRLLQL-SHRLKELYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYF 141
            |:.:.|||.:..|...:...:.|.|| .||...::.::|:..|... |.:....|.    .|||.
  Fly    92 LNLWKMLSLKTHFENLLNEFEELFQLIKHRAYRIHHYQEKYTRHIR-NTFIFHTSA----VVYYN 151

  Fly   142 VMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVL------AYVIDFTYSQF 200
            .:.::.:                          .|..|.:.:.|||.:      .:.:..:...|
  Fly   152 SLPILLM--------------------------IREHFSNSQQLGYRIQSNTWYPWQVQGSIPGF 190

  Fly   201 IVNV-----SLGTDLWMMCVSS-----------QISMHLGYLANMLASI-RPSPETEQQDCDFLA 248
            ...|     |..|:   |||:.           |:.:|...||..|.:| ..:|..:.|    |.
  Fly   191 FAAVACQIFSCQTN---MCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQ----LK 248

  Fly   249 SIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASVAAQF 313
            .:|..|..::.|...||..|......:|..:....|.:|:...:..|.......:.|...:...|
  Fly   249 YLIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITYNF 313

  Fly   314 YVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKI 378
            .:..| |..||..|..:..|||.:.||||.|.|::.:||||.:|.:|.......:..:|:.|:..
  Fly   314 SMCRS-GTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMA 377

  Fly   379 LMTITYRFFAVIR 391
            .:..:|:.|..:|
  Fly   378 TLKFSYQMFTCVR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 68/319 (21%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 72/329 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.