DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5D and sp3

DIOPT Version :10

Sequence 1:NP_001017915.1 Gene:INPP5D / 3635 HGNCID:6079 Length:1189 Species:Homo sapiens
Sequence 2:NP_001036740.2 Gene:sp3 / 42545 FlyBaseID:FBgn0038890 Length:1142 Species:Drosophila melanogaster


Alignment Length:237 Identity:54/237 - (22%)
Similarity:92/237 - (38%) Gaps:71/237 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   146 SNENPRATETSRPSLSETLFQRLQSMDTSGLPEEHL-------KAIQDYLSTQLAQDSEFV--KT 201
            ||.|..|   ..||:...:..:.:...:|.....||       |..:|.|:..:...::.|  .|
  Fly   955 SNYNENA---FLPSVGIVMGNQKEDSPSSSDEIRHLEQKDSMCKTTEDVLTISITSVTDHVGLPT 1016

Human   202 G-SSSLPHLKKLT--TLLCKELY------GEVIRTLPSLESLQRLFDQQLS-PGLRPRPQVPGEA 256
            | ..:.|.::.:|  .|:|.|.:      .|.::.:.|..:      :.|| |||...|    ||
  Fly  1017 GLLENAPAIRPITPNPLICVEAHEAFDDREEGVKPVSSTSA------RDLSLPGLPTHP----EA 1071

Human   257 NPINMVSKLSQLTSLLSSIEDKVKALLHEGPESPHRPSLIPPVTFEVKAESLGI---PQKMQLKV 318
            |      ||.||||.||.:                             |:::|:   |:|:..|.
  Fly  1072 N------KLKQLTSPLSKL-----------------------------AKNIGLNLDPRKIATKT 1101

Human   319 DVESGKLIIKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVIL 360
            .|.|..::..::.....|. .|...:|:|.:::|...||:.|
  Fly  1102 GVLSPTILSAENSPPERDP-SSRDHLLELWEAEKCKTKLIAL 1142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5DNP_001017915.1 SH2_SHIP 1..102 CDD:198206
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..132
SH3-binding 1 124..129
INPP5c_SHIP1-INPP5D 404..710 CDD:197334
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 870..906
PHA03307 899..>1127 CDD:223039
NPXY motif 1 912..915
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 922..1189
SH3-binding 2 969..974
Interaction with DAB2. /evidence=ECO:0000250 1016..1030
NPXY motif 2 1019..1022
SH3-binding 3 1040..1051
sp3NP_001036740.2 COG5329 <197..586 CDD:227637
hSac2 663..768 CDD:463592
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.