DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ad and Lcp65Ag3

DIOPT Version :9

Sequence 1:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:78 Identity:29/78 - (37%)
Similarity:43/78 - (55%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AAAQARIVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPEGLRV 127
            ||.:..||...:||  |..|:.|::||.:|...:..|...:||.:.:...|.|:|.||..:|...
  Fly    19 AAEEPTIVRSESDV--GPESFKYDWETSDGQAAQAVGQLNDIGTENEAISVSGSYRFIADDGQTY 81

  Fly   128 GVKYLADANGFRP 140
            .|.|:||.|||:|
  Fly    82 QVNYIADKNGFQP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 18/54 (33%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:278791 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.