DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ad and Cpr65Ax1

DIOPT Version :10

Sequence 1:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster


Alignment Length:79 Identity:28/79 - (35%)
Similarity:42/79 - (53%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IAAAQARIVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPEGLR 126
            :|.|...:....:|.|.|..:|||..||.:|....|.||..|.|.:.:.....|::|::.|:|..
  Fly    13 VALAAPTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAISTHGSFSYVGPDGQT 77

  Fly   127 VGVKYLADANGFRP 140
            ..|.|:||.|||:|
  Fly    78 YTVTYVADENGFQP 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:459790 20/54 (37%)
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:459790 20/54 (37%)

Return to query results.
Submit another query.