DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ad and Cpr97Ea

DIOPT Version :10

Sequence 1:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster


Alignment Length:135 Identity:38/135 - (28%)
Similarity:57/135 - (42%) Gaps:43/135 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YKKYNPYIA-------AAQAR----------IVEQNNDVNYGAGSYSYNYETENGIHGEERGVPV 102
            |::..|..|       ||.||          |::|.|..|.. |||:|.||..:|        ..
  Fly    28 YQENTPRTAPLRLRANAAPARAEAPRADPVAILKQINKHNED-GSYTYGYEGADG--------SF 83

  Fly   103 NIGNQQQEEQVEGAYSFITPEG-LRVGVKYLADANGFRPVITYDGVNSA-------------FYA 153
            .|..:....:|:|.|.::...| :|| |:|.|:..||:|  :.:|:..|             .||
  Fly    84 KIETKLATGEVKGKYGYVDETGKVRV-VEYGANKYGFQP--SGEGITVAPPTLVDETLKEEPDYA 145

  Fly   154 GQPAP 158
            .:|||
  Fly   146 DEPAP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:459790 15/55 (27%)
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 15/55 (27%)

Return to query results.
Submit another query.