DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ad and Edg78E

DIOPT Version :9

Sequence 1:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster


Alignment Length:158 Identity:38/158 - (24%)
Similarity:52/158 - (32%) Gaps:55/158 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFSCLFVLTLAAIACEGQPQYNPYLRNPYYRDLYYRNRDLYNLRRFYDGFYKKYNPYIAAAQARI 69
            ::..||.|.|...||...                 .|:|                       |:|
  Fly     1 MYKYLFCLALIGCACADN-----------------INKD-----------------------AQI 25

  Fly    70 VEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPEGLRVGVKYLAD 134
            ....||.....|:|.|.|||.|||..:|.|         ......||.::::|||..:.:.|.||
  Fly    26 RSFQNDATDAEGNYQYAYETSNGIQIQEAG---------NANGARGAVAYVSPEGEHISLTYTAD 81

  Fly   135 ANGFRPVITYDGVNSAFYAGQPAPANVV 162
            ..|:.|      |........|.||.|:
  Fly    82 EEGYHP------VGDHLPTPPPVPAYVL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 18/54 (33%)
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 18/54 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439244
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.